PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G28610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 500aa    MW: 52995 Da    PI: 6.2953
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G28610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.22.4e-109784542374
             GRAS   2 velLlecAeavssgdlelaqalLarlsel..aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                      v+l+++cA a+++gd ++a   L+  +e+    p+  + + R+ ++f+ ALa+rl+   ++   + pp + +     e+   ++ f+e+ P+lk
  ORUFI05G28610.1  78 VNLMVTCAGAIQAGDYAAAAGSLSDAREIfaKMPTTrTGIGRVLTHFADALAERLFPAFPQ---SAPPPPPP---RGEQRELFRGFYEAGPYLK 165
                      6899************************98644444499*****************94443...33444444...4555567899********* PP

             GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                      f+hl+aNqaIlea+eg++ vH+iDf ++ G+QWp+L+qaLa Rp+gpp lRiTg+g++++g+++el+ +g rLa+fA+++ vpf f+ ++a++l
  ORUFI05G28610.1 166 FAHLAANQAILEAFEGCNSVHVIDFALTDGIQWPSLIQALAVRPGGPPFLRITGIGPHAAGNRDELRDVGLRLAEFARSCSVPFAFRGIAADQL 259
                      *********************************************************9999********************************* PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                      + l++++++v pgEa+a+n+vlqlhrll ++ + +      ++d vL+ v s++P+v++vveqeadhn++s+lerf+++l yy+++fdslea  
  ORUFI05G28610.1 260 DGLRPWMFQVAPGEAVAINSVLQLHRLLVDQDAAAAasfpaPIDGVLDWVASMNPRVFTVVEQEADHNKSSLLERFTNSLFYYASMFDSLEAIS 353
                      ***************************9544333333455599***********************************************9874 PP

             GRAS 276 pres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                       +     + + + +++l+ ei ++v+ eg++r+erhe++ +W erl++ G++++pl+ +   qa + lr++++ g+ v+e+ g l+l+W++++L
  ORUFI05G28610.1 354 RHGGgdGAGNPLAEAYLQGEIADIVSREGSSRVERHEQMPRWVERLRRGGMTQLPLGATGLWQAAMQLREFSGAGFGVQENGGFLTLTWHSQRL 447
                      33334599999*********************************************************************************** PP

             GRAS 368 vsvSaWr 374
                      +s+SaWr
  ORUFI05G28610.1 448 YSASAWR 454
                      ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.10151434IPR005202Transcription factor GRAS
PfamPF035148.4E-10778454IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MAQFGGFGGW SAMDVAAAAA AALGNVSGAV YHADPAAAVY ASLVPGMAVV PGRAPPSAVQ  60
IEAARRWKEL EKMALRSVNL MVTCAGAIQA GDYAAAAGSL SDAREIFAKM PTTRTGIGRV  120
LTHFADALAE RLFPAFPQSA PPPPPPRGEQ RELFRGFYEA GPYLKFAHLA ANQAILEAFE  180
GCNSVHVIDF ALTDGIQWPS LIQALAVRPG GPPFLRITGI GPHAAGNRDE LRDVGLRLAE  240
FARSCSVPFA FRGIAADQLD GLRPWMFQVA PGEAVAINSV LQLHRLLVDQ DAAAAASFPA  300
PIDGVLDWVA SMNPRVFTVV EQEADHNKSS LLERFTNSLF YYASMFDSLE AISRHGGGDG  360
AGNPLAEAYL QGEIADIVSR EGSSRVERHE QMPRWVERLR RGGMTQLPLG ATGLWQAAMQ  420
LREFSGAGFG VQENGGFLTL TWHSQRLYSA SAWRATAGKK MTMMASGAAD AMEESQNSNT  480
NGGGGGSSGG GHGALNQIMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4411945442375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0988320.0AC098832.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1268_B08, complete sequence.
GenBankAK1072560.0AK107256.1 Oryza sativa Japonica Group cDNA clone:002-125-G08, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638486.10.0PREDICTED: DELLA protein SLR1-like
TrEMBLA0A0E0PRK20.0A0A0E0PRK2_ORYRU; Uncharacterized protein
TrEMBLQ6F3680.0Q6F368_ORYSJ; Os05g0574900 protein
STRINGLOC_Os05g49930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.12e-88GRAS family protein